BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0164 (665 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z50797-5|CAA90675.1| 342|Caenorhabditis elegans Hypothetical pr... 29 3.9 AF067942-1|AAG45570.1| 488|Caenorhabditis elegans Hypothetical ... 28 5.2 >Z50797-5|CAA90675.1| 342|Caenorhabditis elegans Hypothetical protein T22H6.4 protein. Length = 342 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 3 FFFCFAARATSVKMEYFERK*IIYKTTFSIYEFKNYAMVKY 125 FF+ + A KM YF+ K I Y SI+ F + + Y Sbjct: 107 FFYRYIAVCKPEKMYYFDEKHICYTFVLSIFIFVAWTITTY 147 >AF067942-1|AAG45570.1| 488|Caenorhabditis elegans Hypothetical protein ZK6.8 protein. Length = 488 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +2 Query: 191 KFSTRXFRILCX---GYGHECV*NGC 259 K S R F +LC G+GH C+ GC Sbjct: 13 KMSPRAFELLCVVMLGFGHLCIMTGC 38 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,863,636 Number of Sequences: 27780 Number of extensions: 254470 Number of successful extensions: 347 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 347 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1497472076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -