BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0163 (666 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 5.0 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 6.5 AY341177-1|AAR13741.1| 230|Anopheles gambiae ferredoxin reducta... 23 6.5 AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. 23 6.5 AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. 23 6.5 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 6.5 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 6.5 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 6.5 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 6.5 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 8.7 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.8 bits (49), Expect = 5.0 Identities = 15/61 (24%), Positives = 24/61 (39%) Frame = +2 Query: 227 FRTCETCYSNKDGLELAQAEALDKDICLLVDEKDNFIGTATKRECHKVGPDGDVLLHRAF 406 FR C+ +GL L + + D+ C+ E + K CH+ P H F Sbjct: 228 FRVYHRCFGRGEGLFLPELYSYDEQSCIECAECRGLF-SPQKFVCHQHEPQEIRTCHWGF 286 Query: 407 S 409 + Sbjct: 287 N 287 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 84 EDLGIHCYLYYIVM 125 ED+G++ Y YY +M Sbjct: 227 EDIGLNAYYYYFMM 240 >AY341177-1|AAR13741.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 23.4 bits (48), Expect = 6.5 Identities = 13/49 (26%), Positives = 19/49 (38%) Frame = +2 Query: 164 VGQKANKITVEHPKSREKIFGFRTCETCYSNKDGLELAQAEALDKDICL 310 +GQ+ ++ E G R C +EL LD DIC+ Sbjct: 11 IGQRVMELFEEKGVQFVMNSGIRRCIGAEGTVQQVELTDGTLLDADICI 59 >AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 23.4 bits (48), Expect = 6.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 244 GFTGSEAKNLFSTLRVLHSDLVSFLTNIFVCMNFTELHFYI 122 G T S+ L + ++ DLV+ NIFV M F E Y+ Sbjct: 25 GLTKSQKVALIAAWSIVKKDLVTHGRNIFV-MFFEEYPQYL 64 >AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 23.4 bits (48), Expect = 6.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 244 GFTGSEAKNLFSTLRVLHSDLVSFLTNIFVCMNFTELHFYI 122 G T S+ L + ++ DLV+ NIFV M F E Y+ Sbjct: 25 GLTKSQKVALIAAWSIVKKDLVTHGRNIFV-MFFEEYPQYL 64 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 451 EIKPKSNISRLLHKCLLQPSLXIDEKP 531 ++K N SR+ C++ P+ DE+P Sbjct: 788 KVKTTINTSRIPSMCIITPTNSDDEQP 814 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 84 EDLGIHCYLYYIVM 125 ED+G++ Y YY +M Sbjct: 227 EDIGLNAYYYYFMM 240 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 84 EDLGIHCYLYYIVM 125 ED+G++ Y YY +M Sbjct: 227 EDIGLNAYYYYFMM 240 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 84 EDLGIHCYLYYIVM 125 ED+G++ Y YY +M Sbjct: 227 EDIGLNAYYYYFMM 240 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 8.7 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 614 HDVPVRANCLVDSQFMVHPTS 552 HDVP+ CL + ++ P S Sbjct: 1075 HDVPLNQGCLAPIEVIIPPGS 1095 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,322 Number of Sequences: 2352 Number of extensions: 13434 Number of successful extensions: 33 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -