BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0157 (467 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.4 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 7.5 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 247 PNLNFKWLCCKVAKMSLIPK*PFTLT*PNL 336 P+LN K L + KM + PFT+ P L Sbjct: 259 PDLNHKPLNLTIKKMPIAIVAPFTIVEPKL 288 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 247 PNLNFKWLCCKVAKMSLIPK*PFTLT*PNL 336 P+LN K L + KM + PFT+ P L Sbjct: 151 PDLNHKPLNLTIKKMPIAIVAPFTIVEPKL 180 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 20.6 bits (41), Expect = 7.5 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +2 Query: 104 VYVTFIFVIKDAFYLVSSINNSMFL 178 VYV +++++ Y+V+ + FL Sbjct: 269 VYVLILYILESLLYMVTKLVVVTFL 293 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,414 Number of Sequences: 336 Number of extensions: 1957 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10826639 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -