BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0155 (430 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 32 0.19 At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.25 At4g00910.1 68417.m00124 expressed protein contains Pfam profile... 30 0.77 At4g02710.1 68417.m00366 kinase interacting family protein simil... 29 1.8 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 28 2.3 At2g30530.1 68415.m03718 expressed protein 27 4.1 At2g26780.1 68415.m03212 expressed protein contains Pfam profile... 27 4.1 At1g67900.2 68414.m07754 phototropic-responsive NPH3 family prot... 27 4.1 At1g67900.1 68414.m07753 phototropic-responsive NPH3 family prot... 27 4.1 At2g04230.1 68415.m00410 F-box family protein contains F-box dom... 27 5.4 At2g36200.1 68415.m04444 kinesin motor protein-related 27 7.1 At5g64710.2 68418.m08135 expressed protein contains Pfam profile... 26 9.4 At5g64710.1 68418.m08134 expressed protein contains Pfam profile... 26 9.4 At4g39420.1 68417.m05579 expressed protein ; expression support... 26 9.4 At4g11720.1 68417.m01870 hypothetical protein 26 9.4 At1g65010.1 68414.m07368 expressed protein similar to endosome-a... 26 9.4 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 31.9 bits (69), Expect = 0.19 Identities = 21/59 (35%), Positives = 30/59 (50%) Frame = +2 Query: 35 DEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 211 D K +K+H CL+ + DE N L+T + K + P+K+ A L K KDGK Sbjct: 77 DVHKSFVKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.25 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -1 Query: 370 ERASGLSRGSISHNSRLFGEGCCLCWPGKRQS 275 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At4g00910.1 68417.m00124 expressed protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 497 Score = 29.9 bits (64), Expect = 0.77 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +3 Query: 198 PRTGNSRRTSLWLKCLMLKQIESREA 275 PR+G S+R LWLK L++K I R A Sbjct: 25 PRSGLSKRIFLWLKDLVMKVIMERVA 50 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 391 DYVFTRKERASGLSRGSISHNSRLFGEGCCL 299 DYVFT +E A +S+G+ + L EG CL Sbjct: 781 DYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 28.3 bits (60), Expect = 2.3 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +2 Query: 62 HRADCLSETKADEQLVNKLKT-GDFKTENEPLKKYALCMLIKSQLMTKD-GKFKKDVALA 235 H D + E + + K++T GD+K EN L +Y C+L + +D G K + LA Sbjct: 227 HTVDLMLEAISKLPKMGKMQTFGDYKGENLFLNRYESCVLEWCDVCVEDFGPLMKLLRLA 286 Query: 236 KVPN 247 N Sbjct: 287 DGEN 290 >At2g30530.1 68415.m03718 expressed protein Length = 371 Score = 27.5 bits (58), Expect = 4.1 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -3 Query: 176 AYIEHTSSMVRFQS*SRLSSVCSPIVHQLSSRRDSRLCVSSSSPSAHL*GPEPRXPK 6 +Y +S S S SS+ + + S+ RDS L + SSPS+ P P PK Sbjct: 34 SYSSSSSPSPSSASSSAASSLAAKAIRASSAHRDSSLSSAYSSPSS---APVPTPPK 87 >At2g26780.1 68415.m03212 expressed protein contains Pfam profile TBP (TATA-binding protein) -interacting protein 120 (TIP120); contains TIGRFAM profile TIGR01612: reticulocyte binding protein Length = 1866 Score = 27.5 bits (58), Expect = 4.1 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 282 RLPGQQRQQPSPNSLELCEMLPRERPE 362 R P ++R++ +PN+LE LP++ E Sbjct: 114 RAPAKEREEIAPNTLENVSKLPKQHQE 140 >At1g67900.2 68414.m07754 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 631 Score = 27.5 bits (58), Expect = 4.1 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = +1 Query: 187 TADDQGREIQEGRRSG*SA*C*SKLKVEKLIDACL 291 +A++ E QE RRS SA SKLKV KL+D L Sbjct: 384 SAENIDLEFQESRRSS-SASHSSKLKVAKLVDGYL 417 >At1g67900.1 68414.m07753 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 631 Score = 27.5 bits (58), Expect = 4.1 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = +1 Query: 187 TADDQGREIQEGRRSG*SA*C*SKLKVEKLIDACL 291 +A++ E QE RRS SA SKLKV KL+D L Sbjct: 384 SAENIDLEFQESRRSS-SASHSSKLKVAKLVDGYL 417 >At2g04230.1 68415.m00410 F-box family protein contains F-box domain Pfam:PF00646 Length = 448 Score = 27.1 bits (57), Expect = 5.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 256 KLKVEKLIDACLANKGNSPHQTAWNYVKCYHE 351 KL++ KL D L + +P + WN KC E Sbjct: 337 KLQILKLTDVYLHDNKTNPDERKWNPPKCAPE 368 >At2g36200.1 68415.m04444 kinesin motor protein-related Length = 1056 Score = 26.6 bits (56), Expect = 7.1 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 23 QALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPL 154 Q EQ NL A CLS+ Q VNKL + N+ + Sbjct: 542 QVELSEQISNLFNRVASCLSQQNVHLQGVNKLSQSRLEAHNKAI 585 >At5g64710.2 68418.m08135 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 716 Score = 26.2 bits (55), Expect = 9.4 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 3/73 (4%) Frame = +2 Query: 11 VXLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 181 V + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 237 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 296 Query: 182 KSQLMTKDGKFKK 220 S KDG KK Sbjct: 297 VSSFEEKDGFLKK 309 >At5g64710.1 68418.m08134 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 841 Score = 26.2 bits (55), Expect = 9.4 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 3/73 (4%) Frame = +2 Query: 11 VXLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 181 V + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 362 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 421 Query: 182 KSQLMTKDGKFKK 220 S KDG KK Sbjct: 422 VSSFEEKDGFLKK 434 >At4g39420.1 68417.m05579 expressed protein ; expression supported by MPSS Length = 781 Score = 26.2 bits (55), Expect = 9.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 85 LGETVGSVFLQVLLLLICEGLS 20 +GE+VG F L L+ C+GLS Sbjct: 675 IGESVGCSFQGFLFLVTCDGLS 696 >At4g11720.1 68417.m01870 hypothetical protein Length = 658 Score = 26.2 bits (55), Expect = 9.4 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 307 CCLCWPGKRQSASL--LSICFSIRHFSQSDVLLE 212 CC C P +R +S + +CFS F + D +++ Sbjct: 189 CCPCGPQRRMPSSCGDICMCFSFVTFKEFDKMIK 222 >At1g65010.1 68414.m07368 expressed protein similar to endosome-associated protein (GI:1016368) [Homo sapiens]; similar to Centromeric protein E (CENP-E protein) (Swiss-Prot:Q02224) [Homo sapiens] Length = 1318 Score = 26.2 bits (55), Expect = 9.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 35 DEQKENLKKHRADCLSETKADEQLVNK 115 DEQ E LKK +A + + K E+LV + Sbjct: 71 DEQIELLKKDKAKAIDDLKESEKLVEE 97 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,195,674 Number of Sequences: 28952 Number of extensions: 179623 Number of successful extensions: 488 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -