BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0136 (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 177 7e-45 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 177 9e-45 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 177 9e-45 SB_56| Best HMM Match : Actin (HMM E-Value=0) 177 9e-45 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 176 1e-44 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 175 4e-44 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 154 7e-38 SB_54| Best HMM Match : Actin (HMM E-Value=0) 97 9e-21 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 59 3e-09 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 54 1e-07 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 52 4e-07 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) 31 1.1 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 29 3.4 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_27551| Best HMM Match : rve (HMM E-Value=6.3e-25) 28 6.0 SB_612| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_40578| Best HMM Match : Pkinase (HMM E-Value=2.2e-11) 28 7.9 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 28 7.9 SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) 28 7.9 SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) 28 7.9 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 28 7.9 SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 177 bits (431), Expect = 7e-45 Identities = 81/85 (95%), Positives = 85/85 (100%) Frame = +3 Query: 255 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 434 KDLYANTV+SGGTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLS Sbjct: 265 KDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLS 324 Query: 435 TFQQMWISKQEYDESGPSIVHRKCF 509 TFQQMWISKQEYDESGP+IVHRKCF Sbjct: 325 TFQQMWISKQEYDESGPAIVHRKCF 349 Score = 155 bits (377), Expect = 2e-38 Identities = 72/81 (88%), Positives = 75/81 (92%) Frame = +1 Query: 16 DIKEXLCYVFLDFEQEMATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME 195 DIKE LCYV LDFEQEM T ASSSS+EKSYELPDGQVITIGNERFRCPEAL QPSFLGME Sbjct: 185 DIKEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGME 244 Query: 196 ACGIHETTYNSIMKCDVDIRR 258 + GIHETTYNSIMKCDVDIR+ Sbjct: 245 SSGIHETTYNSIMKCDVDIRK 265 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 177 bits (430), Expect = 9e-45 Identities = 82/85 (96%), Positives = 84/85 (98%) Frame = +3 Query: 255 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 434 KDLYANTVLSGGTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLS Sbjct: 254 KDLYANTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLS 313 Query: 435 TFQQMWISKQEYDESGPSIVHRKCF 509 TFQQMWISKQEYDESGP+IVHRKCF Sbjct: 314 TFQQMWISKQEYDESGPAIVHRKCF 338 Score = 158 bits (384), Expect = 3e-39 Identities = 73/81 (90%), Positives = 76/81 (93%) Frame = +1 Query: 16 DIKEXLCYVFLDFEQEMATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME 195 DIKE LCYV LDFEQEM T ASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME Sbjct: 174 DIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGME 233 Query: 196 ACGIHETTYNSIMKCDVDIRR 258 + GIHETTYNSIMKCDVDIR+ Sbjct: 234 SAGIHETTYNSIMKCDVDIRK 254 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 177 bits (430), Expect = 9e-45 Identities = 82/85 (96%), Positives = 84/85 (98%) Frame = +3 Query: 255 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 434 KDLYANTVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLS Sbjct: 292 KDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLS 351 Query: 435 TFQQMWISKQEYDESGPSIVHRKCF 509 TFQQMWISKQEYDESGPSIVHRKCF Sbjct: 352 TFQQMWISKQEYDESGPSIVHRKCF 376 Score = 158 bits (384), Expect = 3e-39 Identities = 73/81 (90%), Positives = 76/81 (93%) Frame = +1 Query: 16 DIKEXLCYVFLDFEQEMATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME 195 DIKE LCYV LDFEQEM T ASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME Sbjct: 212 DIKEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGME 271 Query: 196 ACGIHETTYNSIMKCDVDIRR 258 + GIHETTYNSIMKCDVDIR+ Sbjct: 272 SAGIHETTYNSIMKCDVDIRK 292 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 177 bits (430), Expect = 9e-45 Identities = 82/85 (96%), Positives = 84/85 (98%) Frame = +3 Query: 255 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 434 KDLYANTVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLS Sbjct: 291 KDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLS 350 Query: 435 TFQQMWISKQEYDESGPSIVHRKCF 509 TFQQMWISKQEYDESGPSIVHRKCF Sbjct: 351 TFQQMWISKQEYDESGPSIVHRKCF 375 Score = 158 bits (384), Expect = 3e-39 Identities = 73/81 (90%), Positives = 76/81 (93%) Frame = +1 Query: 16 DIKEXLCYVFLDFEQEMATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME 195 DIKE LCYV LDFEQEM T ASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME Sbjct: 211 DIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGME 270 Query: 196 ACGIHETTYNSIMKCDVDIRR 258 + GIHETTYNSIMKCDVDIR+ Sbjct: 271 SAGIHETTYNSIMKCDVDIRK 291 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 176 bits (429), Expect = 1e-44 Identities = 82/85 (96%), Positives = 84/85 (98%) Frame = +3 Query: 255 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 434 KDLYANTVLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLS Sbjct: 292 KDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLS 351 Query: 435 TFQQMWISKQEYDESGPSIVHRKCF 509 TFQQMWISKQEYDESGPSIVHRKCF Sbjct: 352 TFQQMWISKQEYDESGPSIVHRKCF 376 Score = 159 bits (385), Expect = 2e-39 Identities = 73/81 (90%), Positives = 76/81 (93%) Frame = +1 Query: 16 DIKEXLCYVFLDFEQEMATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME 195 DIKE LCYV LDFEQEM T ASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME Sbjct: 212 DIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGME 271 Query: 196 ACGIHETTYNSIMKCDVDIRR 258 + GIHETTYNSIMKCDVDIR+ Sbjct: 272 SAGIHETTYNSIMKCDVDIRK 292 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 175 bits (425), Expect = 4e-44 Identities = 81/85 (95%), Positives = 84/85 (98%) Frame = +3 Query: 255 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 434 KDLYANTVLSGG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLS Sbjct: 291 KDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLS 350 Query: 435 TFQQMWISKQEYDESGPSIVHRKCF 509 TFQQMWISKQEYDESGPSIVHRKCF Sbjct: 351 TFQQMWISKQEYDESGPSIVHRKCF 375 Score = 155 bits (377), Expect = 2e-38 Identities = 72/81 (88%), Positives = 76/81 (93%) Frame = +1 Query: 16 DIKEXLCYVFLDFEQEMATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME 195 DIKE L YV LDFEQEMAT A+SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME Sbjct: 211 DIKEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGME 270 Query: 196 ACGIHETTYNSIMKCDVDIRR 258 + GIHETTYNSIMKCDVDIR+ Sbjct: 271 SAGIHETTYNSIMKCDVDIRK 291 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 154 bits (373), Expect = 7e-38 Identities = 69/85 (81%), Positives = 78/85 (91%) Frame = +3 Query: 255 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 434 KDLY+N VLSGG+TM+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSILASLS Sbjct: 65 KDLYSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLS 124 Query: 435 TFQQMWISKQEYDESGPSIVHRKCF 509 TFQQMWI+K+EY E GP IVHRKCF Sbjct: 125 TFQQMWIAKEEYHEYGPPIVHRKCF 149 Score = 110 bits (265), Expect = 9e-25 Identities = 50/65 (76%), Positives = 56/65 (86%) Frame = +1 Query: 64 MATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCD 243 M A+S LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGMEA GIHE YN IMKCD Sbjct: 1 MDIDANSPILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCD 60 Query: 244 VDIRR 258 VDIR+ Sbjct: 61 VDIRK 65 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 97.5 bits (232), Expect = 9e-21 Identities = 43/80 (53%), Positives = 55/80 (68%) Frame = +1 Query: 16 DIKEXLCYVFLDFEQEMATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME 195 D+KE LCY +D+E+E+ +S E Y LPDGQ I IG+ERFR E LFQPS LG + Sbjct: 2256 DLKETLCYCAMDYERELKEAETSDDCEAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRD 2315 Query: 196 ACGIHETTYNSIMKCDVDIR 255 GIHE+ + SI KCD+D+R Sbjct: 2316 IDGIHESIFKSIKKCDIDLR 2335 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 78.6 bits (185), Expect = 4e-15 Identities = 34/79 (43%), Positives = 48/79 (60%) Frame = +1 Query: 19 IKEXLCYVFLDFEQEMATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA 198 +KE LCYV + EQE ++ L + Y LPDG+V+ + ERF PEALFQP + +E Sbjct: 216 MKEKLCYVGYNIEQEQKLALETTVLVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEG 275 Query: 199 CGIHETTYNSIMKCDVDIR 255 G+ E +N+I D+D R Sbjct: 276 VGVAELLFNTIQAADIDTR 294 Score = 49.2 bits (112), Expect = 3e-06 Identities = 34/104 (32%), Positives = 51/104 (49%), Gaps = 2/104 (1%) Frame = +3 Query: 177 LVLGYGSLRHPRDNI*LHHEVRRGHPKDLYANTVLSGGTTMYPGIADRMQKEITA-LAPS 353 +VL GS +P L E+ K LY VL G T+ Q +TA Sbjct: 301 IVLSGGSTMYPGLPSRLEREI-----KQLYLERVLKGDTSKLSSGMGMEQIPLTADYLLQ 355 Query: 354 TMKIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESG 482 KI+I PP RK+ V++GG++LA + W++++EY+E G Sbjct: 356 KFKIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 59.3 bits (137), Expect = 3e-09 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 16/101 (15%) Frame = +3 Query: 255 KDLYANTVLSGGTTMYPGIADRMQKEITA----------------LAPSTMKIKIIAPPE 386 + LY N VLSGG+TM+ R+Q++I + P ++ ++I+ Sbjct: 240 RPLYKNIVLSGGSTMFRDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHM 299 Query: 387 RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 509 ++Y+VW GGS+LAS F + +K +YDE GPSI F Sbjct: 300 QRYAVWFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPF 340 Score = 32.3 bits (70), Expect = 0.37 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Frame = +1 Query: 43 FLDFEQEMATXASS-SSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME-ACGIHET 216 F +EQE A S+ + P + + ERF PE F P F + + E Sbjct: 169 FAKYEQEPAKWIKKYESINAVTKKPFS--VDVAYERFLGPEIFFHPEFSNPDFTTPLSEV 226 Query: 217 TYNSIMKCDVDIRR 258 N I C +D+RR Sbjct: 227 VDNVIQNCPIDVRR 240 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 53.6 bits (123), Expect = 1e-07 Identities = 22/60 (36%), Positives = 42/60 (70%), Gaps = 3/60 (5%) Frame = +3 Query: 261 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASL 431 L+ + +++GG T+ G +R+ +E+ + P +M++K+I+ E++++ WIGGSILASL Sbjct: 171 LFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIGGSILASL 230 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 52.0 bits (119), Expect = 4e-07 Identities = 25/57 (43%), Positives = 34/57 (59%) Frame = +1 Query: 16 DIKEXLCYVFLDFEQEMATXASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL 186 DIKE +CY+ D +E+ ++ L K Y LPDGQ+I+IG E E LF+P L Sbjct: 842 DIKEKICYLSKDHLKEVHNYKTNEGLTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 41.1 bits (92), Expect = 8e-04 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 9/83 (10%) Frame = +3 Query: 255 KDLYANTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIAPP-ERKYSVWI 407 K L N VL GGT M PG R+ +EI L S +K+ PP + W+ Sbjct: 75 KTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNANITAWL 134 Query: 408 GGSILASLSTFQQMWISKQEYDE 476 GG+I SL +++ Y + Sbjct: 135 GGAIFGSLEVLADRSTTRERYQQ 157 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 31.9 bits (69), Expect = 0.49 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 157 PEALFQPSFLGMEACGIHET 216 PE +FQPS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) Length = 152 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +1 Query: 16 DIKEXLCYVFLDFEQEM 66 DIKE LCYV LDF QE+ Sbjct: 90 DIKEKLCYVALDFYQEI 106 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 125 SSPSETKDSVAQRLSSNPRSWVWK 196 S+ SETK SV +R + + W+W+ Sbjct: 96 STKSETKASVVERFNRTSKEWMWR 119 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 270 NTVLSGGTTMYPGIADRMQKEITALAP 350 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_27551| Best HMM Match : rve (HMM E-Value=6.3e-25) Length = 291 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +2 Query: 125 SSPSETKDSVAQRLSSNPRSWVWK--LAASTRQHITP 229 S+ SE K SV +R + ++W+W+ TR+++ P Sbjct: 226 STQSELKASVVERFNRTLKTWMWRWFTHKETRRYVLP 262 >SB_612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 524 TRGAFKALPVYNGGARLVVLLFRDPHLLEGREGG 423 +RG++ +P Y+GGA + +L PH LEG G Sbjct: 400 SRGSYTYIPRYSGGADIDILASPLPH-LEGEAQG 432 >SB_40578| Best HMM Match : Pkinase (HMM E-Value=2.2e-11) Length = 385 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +2 Query: 62 RWPPXHPAAPSRSLTN--FPTVRSSPSETKDSVAQRLSSNPRSWVWKLAASTRQHITPS* 235 R P H A SR+ ++ PT+ S+P E V L NP+S + A+T ++ + Sbjct: 209 RNPFSHGGAESRTYSDKELPTIDSAPPELARLVKLLLRRNPQSRLSADHAATALYVYLNA 268 Query: 236 SATWTSEGLVRQH 274 + W + L+ H Sbjct: 269 PSWWWCDTLLVTH 281 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 125 SSPSETKDSVAQRLSSNPRSWVWK 196 S+ SETK SV +R + + W+W+ Sbjct: 457 STKSETKASVVERFNRTFKGWMWR 480 >SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) Length = 1066 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 436 PSNKCGSRNKSTTSLAPPLYTGSALNAPR 522 P N+ G++ + +L P++TGS L R Sbjct: 879 PGNQAGNKTRPLRALRSPIHTGSTLEVDR 907 >SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26) Length = 212 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 125 SSPSETKDSVAQRLSSNPRSWVWK 196 S+ SETK SV +R + + W+W+ Sbjct: 93 STKSETKASVVERFNRTFKGWMWR 116 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 47 LTSSRRWPPXHPAAPSRSLTNFPTVRSSPSETKDSVAQRLSSNP 178 L S R P PA PSR L+NF + + T+ + + ++NP Sbjct: 1056 LKSRRAMDPKDPATPSRKLSNFIPIITRDKPTR-PLPVKSNNNP 1098 >SB_33253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 125 SSPSETKDSVAQRLSSNPRSWVWK 196 S+ SETK SV +R + + W+W+ Sbjct: 439 STKSETKASVVERFNRTFKGWMWR 462 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,168,511 Number of Sequences: 59808 Number of extensions: 483194 Number of successful extensions: 1676 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1662 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -