BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0131 (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 26 0.23 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 8.7 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 26.2 bits (55), Expect = 0.23 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 575 GFFFAHAYDSGYLRTYVAPNCSLPFSIYVTIFL 477 G+ + GY R Y+A L F Y T FL Sbjct: 130 GYVWTDILGFGYFREYLAEAVQLYFQFYYTYFL 162 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 89 PVSSPTSSVNLE*PLEVTRIDVFPVASVKTTAYTRAPIFLP 211 P S PT + P +R + +SV TTA + ++ P Sbjct: 81 PSSLPTQRTSTSNPTYSSRSVMTSCSSVPTTASYGSDLYFP 121 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,042 Number of Sequences: 336 Number of extensions: 2406 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -