BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0131 (645 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1013 + 25305531-25305611,25305793-25305861,25306115-253062... 30 1.4 05_01_0407 + 3208818-3210218 28 5.5 >12_02_1013 + 25305531-25305611,25305793-25305861,25306115-25306208, 25306292-25306396,25306577-25306660,25306793-25306866, 25307936-25308001,25308892-25308948,25309433-25309477, 25309602-25309655,25310097-25310237 Length = 289 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +2 Query: 128 PLEVTRIDVFPVASVKTTAYTRAPIFLPQSGHALQLQXRLLFIPDNDLYAFT 283 PL++ DV P+ SV+ + +T P F Q + QL + + +NDL +T Sbjct: 61 PLQLLGFDVDPINSVQFSNHTGYPTFRGQVLNGSQLWDLIEGLAENDLLHYT 112 >05_01_0407 + 3208818-3210218 Length = 466 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 222 WPLCGKNIGARVYAVVFTEATGKTSILVTSRGYSRFTELVGELTGP 85 +PL G+ + A + E TG+ ++ V + EL GE+TGP Sbjct: 75 YPLAGRIVEASPGRKLLVECTGEGAVFVAAESGVAMDEL-GEVTGP 119 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,415,015 Number of Sequences: 37544 Number of extensions: 204896 Number of successful extensions: 454 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -