BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0131 (645 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58297| Best HMM Match : DUF630 (HMM E-Value=6.3) 31 0.80 SB_22047| Best HMM Match : Mito_carr (HMM E-Value=0) 28 7.5 >SB_58297| Best HMM Match : DUF630 (HMM E-Value=6.3) Length = 194 Score = 31.1 bits (67), Expect = 0.80 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = -2 Query: 638 DHFLWESX--PLHYVTRYGTRLFGFFFAHAYDSGYLRTYVAPNCSLPFSI-YVTIFL 477 +H LW + +HY+TRY TR +G + Y + Y+ YV C + I YVT ++ Sbjct: 130 NHELWNNDVGQVHYMTRYVTR-YGSHYVTRYFTRYVSRYVT-RCVTRYVIPYVTRYV 184 >SB_22047| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 421 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +2 Query: 92 VSSPTSSVNLE*PLEVTRIDVFPVASVKTT 181 +SSPT V ++ +E R+ +P++SV+ T Sbjct: 148 ISSPTDLVKVQMQMEGRRLSFYPISSVRGT 177 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,017,376 Number of Sequences: 59808 Number of extensions: 267482 Number of successful extensions: 421 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -