BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0130 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47530| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_18912| Best HMM Match : UCH (HMM E-Value=5.3e-06) 29 4.5 >SB_47530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 939 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 611 IXGGVCCG*RRTLANDCVPEVSARKCTYVI*FYVCF*LRLERRRY 477 + GG C + DC+ + C Y + F+V LRLE + + Sbjct: 193 LNGGTCVDLVASYRCDCIKGFNGTNCQYKLGFFVAIWLRLESKTF 237 >SB_18912| Best HMM Match : UCH (HMM E-Value=5.3e-06) Length = 781 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +2 Query: 2 IRHEVLCNIVLNKFCVSPSLYILLCCR--QCQWDGQ 103 + ++ L N+V N C+ S Y LLCC+ +C+ D Q Sbjct: 632 LANKELHNLVSNSQCLLKSAYGLLCCKRNKCELDVQ 667 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,803,521 Number of Sequences: 59808 Number of extensions: 380867 Number of successful extensions: 850 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -