BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0129 (663 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 24 1.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.6 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.9 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 7.9 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 23.8 bits (49), Expect = 1.5 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -3 Query: 298 GSGYLFCSVPRLLRTVLLSHTDHHALMAGPSHDRGEHGARSIISC 164 GS Y+ VP VLL+ TD + S D E+G +C Sbjct: 329 GSNYMQTRVPAWCDRVLLNPTDKMLVQDISSPDAVEYGIIGPTTC 373 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 379 LRVAPEEHPVLLTEAPLNPKANREKM 456 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +1 Query: 478 FNTPAMYVAIQPC 516 FNT ++V ++PC Sbjct: 223 FNTTTIFVPVKPC 235 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +2 Query: 521 AVRVRSYHRYRAGLRRRCLPHRAHLRGIRTPPRHPASGLSRSRP 652 ++ +++HR C P +L I + P HP + S S P Sbjct: 62 SLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPAS-STSLP 104 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 143 GMCKAGFAGD 172 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,316 Number of Sequences: 438 Number of extensions: 4862 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -