BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0128 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 36 4e-04 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 6.2 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 35.9 bits (79), Expect = 4e-04 Identities = 26/72 (36%), Positives = 37/72 (51%), Gaps = 3/72 (4%) Frame = +1 Query: 40 LFFGCRYKEKDYHCREELEGMVGDGNL-SLYCAFSRDQE-DKIYVQHKIFENRETIW-RL 210 LFFGCR + D + R+E E MV G L ++ A SR+ K YVQ I I+ L Sbjct: 1004 LFFGCRQRNLDLY-RQEKEEMVELGVLDKIFLALSRESGFKKTYVQDLIQAEASQIYDML 1062 Query: 211 LNNNAHVFISGN 246 + H ++ G+ Sbjct: 1063 VYEGGHFYVCGD 1074 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 672 SGSNDQNSRDSRRLASGRTRVLPAXP*TI 586 SGSN+Q S SR S T + P T+ Sbjct: 611 SGSNNQTSSASRENTSNTTSMESFKPPTL 639 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,040 Number of Sequences: 438 Number of extensions: 3653 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -