BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0126 (677 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1ZU59 Cluster: Putative uncharacterized protein; n=1; ... 34 3.7 UniRef50_Q9MTD9 Cluster: Ribosomal protein S5; n=1; Toxoplasma g... 33 6.4 >UniRef50_Q1ZU59 Cluster: Putative uncharacterized protein; n=1; Vibrio angustum S14|Rep: Putative uncharacterized protein - Vibrio angustum S14 Length = 84 Score = 33.9 bits (74), Expect = 3.7 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = -2 Query: 307 CHILIYIYYNALISDXIFYKNYLTAFRRTIWHKCYIYIFIL*MVY*IGIMIFLRVIL 137 C +L+ IY+NA IF N LT+ + Y+ IF+ + ++ FL +++ Sbjct: 16 CFLLLQIYFNATFYSIIFITNVLTSRHMVAFFDVYVNIFVFNQCL-VFVVSFLEILI 71 >UniRef50_Q9MTD9 Cluster: Ribosomal protein S5; n=1; Toxoplasma gondii|Rep: Ribosomal protein S5 - Toxoplasma gondii Length = 268 Score = 33.1 bits (72), Expect = 6.4 Identities = 17/69 (24%), Positives = 36/69 (52%) Frame = -2 Query: 292 YIYYNALISDXIFYKNYLTAFRRTIWHKCYIYIFIL*MVY*IGIMIFLRVIL*ICSFSKA 113 +++Y ++ D IFYK Y +T W+ I++F+L + + + I + S K Sbjct: 39 FLFYLYILKDFIFYK-YFFFKNKTYWYLINIFLFLLNLNFLKLLNININNSFNTISKIKK 97 Query: 112 ELACYYVFV 86 ++ YY+++ Sbjct: 98 NISLYYIYI 106 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 495,216,088 Number of Sequences: 1657284 Number of extensions: 7970932 Number of successful extensions: 12120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12116 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -