BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0124 (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12612| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_50702| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_12612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/52 (34%), Positives = 30/52 (57%) Frame = +3 Query: 78 KAEHLIIKGFPEKIVKLNELLETSNFQNRNLSDVHQDLNIPIPTPPATSNNE 233 KAE ++ K FPE++ +L+ LL++ F + V D IPI P + +N+ Sbjct: 5 KAEEVVTKFFPERVTELDNLLKSGMFALNKIPKVQADSIIPISHPNSDHSND 56 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +3 Query: 96 IKGFPEKIVKLNELLETSNFQNRNLSDVHQDLNIPIP---TPPATSNNEPNAKRQR 254 I+ EK+ K NE +E +N LSD+ +LN I S+++PN K Q+ Sbjct: 1947 IEEMREKMRKANEEIEKILSKNSKLSDILNELNSGIENILNEETLSDSDPNVKLQK 2002 >SB_50702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 823 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 245 TSKMDSSELSSNSTIEGTRVYVLPNGSVPCNKPLSDLI 358 T ++DS + N+ I+ T P+GS KP+ D + Sbjct: 635 TVRVDSLGPTENNKIQATYTVTFPSGSAATLKPIDDAV 672 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,402,156 Number of Sequences: 59808 Number of extensions: 413144 Number of successful extensions: 1102 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1100 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -