BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0124 (680 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/n... 26 1.3 AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleo... 26 1.3 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 25 2.2 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 25 2.9 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 6.7 AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility pro... 23 8.9 AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility pro... 23 8.9 AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility pro... 23 8.9 AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility pro... 23 8.9 AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility pro... 23 8.9 AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility pro... 23 8.9 AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility pro... 23 8.9 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 23 8.9 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 23 8.9 >AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 566 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 488 PVYPLVLKHRNCSHPQFSES*MKST 414 P+YPL + H N H +F E+ ST Sbjct: 46 PLYPLTIIHLNDFHARFEETNTVST 70 >AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleotidase protein. Length = 566 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 488 PVYPLVLKHRNCSHPQFSES*MKST 414 P+YPL + H N H +F E+ ST Sbjct: 46 PLYPLTIIHLNDFHARFEETNTVST 70 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 196 FQYQHHLRRQTMSQMLNVKDG 258 FQ + RR+T+ + LN++DG Sbjct: 369 FQLEERRRRRTVIEKLNIEDG 389 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 24.6 bits (51), Expect = 2.9 Identities = 14/52 (26%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +2 Query: 473 QEDTLAE-IQSGRSEAAAFFDQISRYFISRAKIVSKVAKYPHIDDYRRAVRE 625 ++D LAE I++G+S+ + +F + +RY + A V ++ + P + + +R+ Sbjct: 282 KQDLLAEKIKAGKSKLSDYFGEFNRY-QTPADAVCEMGEDPEVIRAKYFIRD 332 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.4 bits (48), Expect = 6.7 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 195 CLNPDVRP-INSDFESLMSLVIHXXXXXXXXXXXXSNAPPLVSKNLCS 55 C NP + +N+ F S LV+H + PP +++N+ S Sbjct: 561 CYNPIIYCYMNARFRSGFILVLHGVPGLQQLCCCIRHTPPAIARNVGS 608 >AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 1 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 29 >AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 1 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 29 >AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 3 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 31 >AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 3 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 31 >AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 480 IHWQRYNQVDQRQLLFLIKSHDISYPGLK 566 I W Y ++ QR + H + YPG + Sbjct: 4 IKWHEYGRITQRCAVRNPTKHVLLYPGFQ 32 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 23.0 bits (47), Expect = 8.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 497 VSLPVYPLVLKHRNCSHPQFSES*MKST 414 VS ++PL + H N H +F E+ ST Sbjct: 41 VSEQLFPLTIIHLNDFHARFEETNTVST 68 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 23.0 bits (47), Expect = 8.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 497 VSLPVYPLVLKHRNCSHPQFSES*MKST 414 VS ++PL + H N H +F E+ ST Sbjct: 41 VSEQLFPLTIIHLNDFHARFEETNTVST 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,516 Number of Sequences: 2352 Number of extensions: 14243 Number of successful extensions: 84 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -