BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= br--0119
(661 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At2g03590.1 68415.m00319 expressed protein similar to SP|Q41706 ... 30 1.6
>At2g03590.1 68415.m00319 expressed protein similar to SP|Q41706 A3
protein (unknown function) {Vigna unguiculata}
Length = 390
Score = 29.9 bits (64), Expect = 1.6
Identities = 12/36 (33%), Positives = 21/36 (58%)
Frame = +3
Query: 30 FVIIXNAFFILFVLNLRTIFWEIL*ENRNLFRIFSN 137
F +AF + +LN+R ++W IL R+ F+ + N
Sbjct: 267 FYFSISAFVVALILNIRFLYWPILGLPRSSFKAYLN 302
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,408,821
Number of Sequences: 28952
Number of extensions: 197434
Number of successful extensions: 413
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 410
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 413
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1383534864
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -