BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0119 (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03590.1 68415.m00319 expressed protein similar to SP|Q41706 ... 30 1.6 >At2g03590.1 68415.m00319 expressed protein similar to SP|Q41706 A3 protein (unknown function) {Vigna unguiculata} Length = 390 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 30 FVIIXNAFFILFVLNLRTIFWEIL*ENRNLFRIFSN 137 F +AF + +LN+R ++W IL R+ F+ + N Sbjct: 267 FYFSISAFVVALILNIRFLYWPILGLPRSSFKAYLN 302 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,408,821 Number of Sequences: 28952 Number of extensions: 197434 Number of successful extensions: 413 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 413 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -