BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0114 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 24 0.94 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 24 0.94 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 24 0.94 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 24 0.94 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 24 0.94 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 0.94 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 24 0.94 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 24 0.94 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 1.2 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.6 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 23 2.9 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 2.9 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 3.8 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 5.0 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 5.0 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.8 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 21 8.8 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 21 8.8 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 8.8 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +2 Query: 383 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLSKSTIPS 529 H + P Y + +R+A+ P TH + +Y D S + + S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +2 Query: 383 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLSKSTIPS 529 H + P Y + +R+A+ P TH + +Y D S + + S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +2 Query: 383 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLSKSTIPS 529 H + P Y + +R+A+ P TH + +Y D S + + S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +2 Query: 383 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLSKSTIPS 529 H + P Y + +R+A+ P TH + +Y D S + + S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +2 Query: 383 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLSKSTIPS 529 H + P Y + +R+A+ P TH + +Y D S + + S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +2 Query: 383 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLSKSTIPS 529 H + P Y + +R+A+ P TH + +Y D S + + S Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 68 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +2 Query: 383 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLSKSTIPS 529 H + P Y + +R+A+ P TH + +Y D S + + S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 0.94 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +2 Query: 383 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLSKSTIPS 529 H + P Y + +R+A+ P TH + +Y D S + + S Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 189 KSPGASTRATCGDRLTVSVHTHRQVCPTSMLW 94 K PG S GD + + V H T++ W Sbjct: 104 KMPGPSVEVCLGDEVIIDVVNHLSSDSTTIHW 135 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/49 (24%), Positives = 20/49 (40%) Frame = +2 Query: 383 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLSKSTIPS 529 H + P Y + +R+A P TH + +Y D S + + S Sbjct: 64 HGLQPTMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVAS 112 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 635 RWCPRRPKLRPP 600 +WCPRR PP Sbjct: 118 KWCPRREWSSPP 129 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 635 RWCPRRPKLRPP 600 +WCPRR PP Sbjct: 274 KWCPRREWSSPP 285 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 3.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 596 IIHKFPDSNLMKSIIFVVAMSNWMESL 516 II +F L + VV +SNW E L Sbjct: 239 IIARFNIERLCNGLKRVVKLSNWREPL 265 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -3 Query: 183 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 94 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 51 MARGPKKHLKRLNAPKAWMLDKLG 122 + R P +++K++N A LD+ G Sbjct: 609 IGRSPDQNVKKINLKHALDLDRRG 632 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -3 Query: 183 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 94 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 51 MARGPKKHLKRLNAPKAWMLDKLG 122 + R P +++K++N A LD+ G Sbjct: 609 IGRSPDQNVKKINLKHALDLDRQG 632 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 399 RRLSTSCVKSSVWRPDLRMFR 461 R+++ C+KS WR L + + Sbjct: 525 RKVTFQCLKSIAWRAFLAVLK 545 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +2 Query: 545 LRRLWTSSSLSPGTCV*SREAVTWGAVGT 631 L+ ++ S SP T + + ++W AV T Sbjct: 218 LQHIFVKSRPSPATIISNVTVISWQAVCT 246 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +2 Query: 545 LRRLWTSSSLSPGTCV*SREAVTWGAVGT 631 L+ ++ S SP T + + ++W AV T Sbjct: 218 LQHIFVKSRPSPATIISNVTVISWQAVCT 246 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +2 Query: 545 LRRLWTSSSLSPGTCV*SREAVTWGAVGT 631 L+ ++ S SP T + + ++W AV T Sbjct: 538 LQHIFVKSRPSPATIISNVTVISWQAVCT 566 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,006 Number of Sequences: 336 Number of extensions: 3426 Number of successful extensions: 22 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -