BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0110 (665 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0068 + 471729-472460,472578-472655,473270-473507,474130-47... 33 0.27 06_02_0325 + 14428065-14428799,14428916-14428993,14429607-144298... 31 0.82 12_02_0061 - 13063434-13063525,13063679-13064566,13064912-130649... 29 2.5 05_03_0356 + 12894195-12894237,12894347-12894484,12894868-128950... 29 2.5 02_05_0430 - 28923784-28923830,28923931-28924341,28924552-289249... 28 7.7 >08_01_0068 + 471729-472460,472578-472655,473270-473507,474130-474205, 474820-474961,475326-475619,476037-476249 Length = 590 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/68 (25%), Positives = 30/68 (44%) Frame = -2 Query: 496 PPST*LGRLTIKPTIADVYPSNGVKYPFNMPWDLTFQDRRQHPHYDKADEALITTAVTFL 317 PP T + R T+ + N VK+ N P ++D P++D+ +E T ++ Sbjct: 442 PPQTDMYRRTVVADDSGTLIENHVKFFNNQPLPHDYEDEGSRPYFDEKEEVDYTDLISQE 501 Query: 316 RHVLERTN 293 H + N Sbjct: 502 EHTSSQPN 509 >06_02_0325 + 14428065-14428799,14428916-14428993,14429607-14429844, 14431199-14431296,14431770-14432063,14432418-14432702 Length = 575 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = -2 Query: 496 PPST*LGRLTIKPTIADVYPSNGVKYPFNMPWDLTFQDRRQHPHYDKADEALITTAVTFL 317 PP T + R T + N VK+ N P ++D P++D+ +E T ++ Sbjct: 403 PPQTDMYRRTAVADDSGTQIENHVKFFNNQPLPHDYEDEGSRPYFDEKEEVDYTDLISQE 462 Query: 316 RHVLERTN 293 H + N Sbjct: 463 EHTSSQPN 470 >12_02_0061 - 13063434-13063525,13063679-13064566,13064912-13064960, 13065059-13065330,13065422-13065797 Length = 558 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 325 TFLRHVLERTNSHKSCYIYTYYNEY 251 TF RHVL S K CYI Y+ Y Sbjct: 43 TFDRHVLVHAKSDKPCYIKAYHGCY 67 >05_03_0356 + 12894195-12894237,12894347-12894484,12894868-12895018, 12895399-12895526,12895704-12895840,12896742-12896847, 12898659-12898762,12899159-12899281,12899620-12899700, 12900159-12900304,12902171-12902243,12902970-12903060, 12904978-12905018,12906079-12906153,12906402-12906569, 12907638-12907676,12907759-12907847,12908014-12908078, 12908794-12908840,12908924-12908983,12909168-12909239, 12910143-12910172,12910526-12910617,12910719-12910802, 12911941-12912046,12912171-12912233,12912776-12912870, 12913000-12913180 Length = 875 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -3 Query: 528 QQCQGPDQAAAHQVPN--WVGSQ*NPLLPTYIHQME*NIPSICH 403 Q+C+ + A +P WVG+ P P IH ++ NI CH Sbjct: 132 QKCKFKWEVPAEDIPKSKWVGTAAKP--PAVIHNLDSNILDFCH 173 >02_05_0430 - 28923784-28923830,28923931-28924341,28924552-28924963, 28925000-28925542,28925790-28925884,28926003-28927033, 28927304-28927452,28927483-28927523,28927594-28928206 Length = 1113 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 325 TFLRHVLERTNSHKSCYIYTYYNEY 251 TF RHVL K CYI Y+ Y Sbjct: 529 TFDRHVLVHAKGDKPCYIKAYHGCY 553 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,021,136 Number of Sequences: 37544 Number of extensions: 401138 Number of successful extensions: 826 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -