BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0108 (662 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 25 0.42 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 3.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 3.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 3.0 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 3.0 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 3.0 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 3.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 3.0 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 5.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.0 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 25.4 bits (53), Expect = 0.42 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 37 RCSRPVVPPVS-CWTPATVSPTPCPXTRDTHSP 132 R R VVPP C P+T+ P P D++ P Sbjct: 195 RSLRCVVPPTEDCDVPSTIPPPPPEEDDDSNIP 227 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 4 PPCTSPSKPFSRCSRPVVPPVSCWTPATVSPTPCPXTRDTHSPTPSCVXT 153 PP ++PS + S + P+S T P +++ SP S T Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASSTSST 176 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 4 PPCTSPSKPFSRCSRPVVPPVSCWTPATVSPTPCPXTRDTHSPTPSCVXT 153 PP ++PS + S + P+S T P +++ SP S T Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 4 PPCTSPSKPFSRCSRPVVPPVSCWTPATVSPTPCPXTRDTHSPTPSCVXT 153 PP ++PS + S + P+S T P +++ SP S T Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 4 PPCTSPSKPFSRCSRPVVPPVSCWTPATVSPTPCPXTRDTHSPTPSCVXT 153 PP ++PS + S + P+S T P +++ SP S T Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 4 PPCTSPSKPFSRCSRPVVPPVSCWTPATVSPTPCPXTRDTHSPTPSCVXT 153 PP ++PS + S + P+S T P +++ SP S T Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 4 PPCTSPSKPFSRCSRPVVPPVSCWTPATVSPTPCPXTRDTHSPTPSCVXT 153 PP ++PS + S + P+S T P +++ SP S T Sbjct: 83 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 132 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 4 PPCTSPSKPFSRCSRPVVPPVSCWTPATVSPTPCPXTRDTHSPTPSCVXT 153 PP ++PS + S + P+S T P +++ SP S T Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 4 PPCTSPSKPFSRCSRPVVPPVSCWTPATVSPTPCPXTRDTHSPTPSCVXT 153 PP ++PS + S + P+S T P +++ SP S T Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSST 176 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 5.2 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -2 Query: 88 PSPESSTIPVVRPDANSERXAWM 20 PS T PD N E AW+ Sbjct: 357 PSKRKGTYAFRTPDENGEGGAWV 379 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -2 Query: 121 YPSXMGTVWETPSPESSTIP 62 YP T W P P +S P Sbjct: 1366 YPEWQPTEWHPPIPPTSEKP 1385 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 76 TPATVSPTPCPXTRDTHSPTPSCVXT 153 TP + + +P P + SPTP V T Sbjct: 38 TPNSAA-SPAPPEEEAASPTPGDVPT 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,524 Number of Sequences: 336 Number of extensions: 2650 Number of successful extensions: 15 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -