BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0106 (646 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 3.3 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 4.4 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 22 5.8 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 7.7 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 180 ICCLGTPLPGPSTSARVWSITSTTLTNF 97 I CL P PG S ++ + L+N+ Sbjct: 5 ISCLVAPFPGASANSEAKRLYDDLLSNY 32 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 4.4 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 467 GIFFLPKVPARSAFXFKLLNTAVLARFLLTRAAVNLNLS*SVICARFSLFANF 309 GI L K P+RS+ L ++L +V++ + RFS F F Sbjct: 543 GITILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRF 595 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 251 RKRGQMLNSMKNGQKVNGP 307 +K ++ M NGQK+ GP Sbjct: 283 KKISELEKEMLNGQKLQGP 301 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -1 Query: 568 ICLSHITCRRHXTYYFLAGF 509 IC S I R H Y + GF Sbjct: 144 ICTSGIVGRTHTVGYIIIGF 163 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,651 Number of Sequences: 438 Number of extensions: 2912 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -