BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0105 (661 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 27 0.14 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.9 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.9 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 2.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.9 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 5.1 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 9.0 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 27.1 bits (57), Expect = 0.14 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 369 IMIGHTSCTICTRDLKISKCPCPLLATPRTVC 464 I G SCT+CT D K + C + + C Sbjct: 767 IPTGFDSCTVCTCDAKYLEIKCKRIYNEKQCC 798 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 544 APGSGVQNTHIQYTQL 591 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 544 APGSGVQNTHIQYTQL 591 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 544 APGSGVQNTHIQYTQL 591 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 544 APGSGVQNTHIQYTQL 591 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 544 APGSGVQNTHIQYTQL 591 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 544 APGSGVQNTHIQYTQL 591 APG G+Q T YTQL Sbjct: 17 APGHGLQPTMGDYTQL 32 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 544 APGSGVQNTHIQYTQL 591 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 544 APGSGVQNTHIQYTQL 591 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 544 APGSGVQNTHIQYTQL 591 APG G+Q T YTQL Sbjct: 61 APGHGLQPTMGDYTQL 76 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 301 WTVIIFRVLCTNWNGVSTNCFR 366 WT+ L W+ STNC R Sbjct: 246 WTIYEMYHLAILWSCTSTNCPR 267 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.0 bits (42), Expect = 9.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 557 PDPGACCPCI 528 PDPG+C P + Sbjct: 45 PDPGSCDPSV 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,838 Number of Sequences: 336 Number of extensions: 3701 Number of successful extensions: 17 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -