BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0105 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) 30 1.9 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_21593| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) 28 7.7 >SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) Length = 434 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 345 SVHKLLPKIMIGHTSCTICTRDLKISKCP 431 S H + I GHT C +CTRD + KCP Sbjct: 245 SRHTPVALIPCGHTFCQMCTRDCR--KCP 271 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -3 Query: 551 PGAC-CPCIKGI-SNSCHQMKECEMSDHS 471 PG+ C C+KG + CH ECE +H+ Sbjct: 580 PGSYKCMCLKGYHGDDCHDANECERGEHT 608 >SB_21593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = +2 Query: 332 RIGMECPQTASENHDRSYKLYNMYKRPENLEVPLSATRDAKNSVYAMNDQTFHTPSFGD 508 R+GM Q E H ++ + ++K E + VP+ ++ K MND + + GD Sbjct: 24 RMGMTECQNTDEVHKKTTHRHGLWKHDEMITVPMMISQMMK---VVMNDDDYKEDNLGD 79 >SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) Length = 1214 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +2 Query: 338 GMECPQTASENHDRSYKLYNMYKRPENLEVPLSATRDAKNSVYAMNDQTFHTPSFG 505 G +CP T+ D M++ E+ A + ++N+ ++ N Q+F TP G Sbjct: 784 GDDCPSTSQREDDNPVS--KMFQE----EIRARARKYSQNTGFSQNQQSFSTPEHG 833 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,262,963 Number of Sequences: 59808 Number of extensions: 470058 Number of successful extensions: 1402 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1401 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -