BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0105 (661 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022385-1|AAY54801.1| 124|Drosophila melanogaster IP05263p pro... 31 1.8 BT003780-1|AAO41461.1| 143|Drosophila melanogaster LP04723p pro... 29 7.4 >BT022385-1|AAY54801.1| 124|Drosophila melanogaster IP05263p protein. Length = 124 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -3 Query: 635 SCAGFIMPTCGAAWC-NCVY*ICVFW-TPDPG--ACCPCIKGISNSC 507 SC G TC WC +C+ W PD G CC C+ + C Sbjct: 78 SCCGIFPETCCGPWCESCLDPSWFSWLAPDLGRSCCCACMTCCRSKC 124 >BT003780-1|AAO41461.1| 143|Drosophila melanogaster LP04723p protein. Length = 143 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 321 SSVHELEWSVHKLLPKIMIGH-TSCTICTRDLKISKCPCPLLATP 452 S++H+ SV ++ PK ++ H T C SK P P++ TP Sbjct: 64 SALHDTPHSVSRMTPKKILCHQTPCHTIACTHARSKTPKPMITTP 108 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,070,087 Number of Sequences: 53049 Number of extensions: 703790 Number of successful extensions: 2142 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2142 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2827453950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -