BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0100 (666 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 27 0.53 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 2.8 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 27.1 bits (57), Expect = 0.53 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 507 PLSNTYCSFEIHLQNVKIAVEFAVNNCSVCVLNGFAXIAV 626 P N + SF HLQ+ FAVNN + G I + Sbjct: 470 PQGNVFASFT-HLQHAPFTYRFAVNNTTGAARRGTCRIFI 508 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 364 RNLKIYLNIISNFDISYERNLSQIYGWQDDEPNI 465 R L + N ISN D + R+++ +YG + E NI Sbjct: 455 RTLDLGENHISNIDNASFRHMAHLYGLRLTENNI 488 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 622,169 Number of Sequences: 2352 Number of extensions: 12038 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -