BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0098 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50069-5|AAY86213.1| 206|Caenorhabditis elegans Hypothetical pr... 29 2.2 Z83744-2|CAB06039.1| 430|Caenorhabditis elegans Hypothetical pr... 28 5.0 >U50069-5|AAY86213.1| 206|Caenorhabditis elegans Hypothetical protein C09B9.8 protein. Length = 206 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 603 ILLFYISDQFCQTYLTXFLDLKRLECWLLLGSST 502 +LLFY+ Q Y T F L+ + L+LGSS+ Sbjct: 8 LLLFYLHPPIIQAYSTTFSRLEPISTRLILGSSS 41 >Z83744-2|CAB06039.1| 430|Caenorhabditis elegans Hypothetical protein C06A12.5 protein. Length = 430 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 472 KSCIFSNTILELG*FNLNFWHFQTLFLHLVLK 377 K I + T+LEL LN WHF+ + + V+K Sbjct: 329 KELISNTTLLELSRPTLNSWHFEKVTIWPVIK 360 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,432,894 Number of Sequences: 27780 Number of extensions: 226513 Number of successful extensions: 356 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -