BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0098 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32785.1 68417.m04664 expressed protein 27 8.2 At4g00570.1 68417.m00080 malate oxidoreductase, putative similar... 27 8.2 >At4g32785.1 68417.m04664 expressed protein Length = 124 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = -1 Query: 323 YYIIXTLQKSILFKAGNQGEYKYVMTRINKIINSLSL 213 Y+ + T+++ I F+ GN+ E + + I +++NSL + Sbjct: 80 YFGVKTVERVIEFECGNKREKQMWIEGIQQLLNSLEI 116 >At4g00570.1 68417.m00080 malate oxidoreductase, putative similar to NAD-dependent malic enzyme 59 kDa isoform, mitochondrial precursor (EC 1.1.1.39) (NAD-ME) (SP:P37225) {Solanum tuberosum} Length = 607 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 432 QPSSKMVLLKIQLLKRLHF*XAFKYYYLVIANIQD 536 +P + + L K ++L RLH YY ++I NI+D Sbjct: 96 EPENVVALAKWRMLNRLHDRNETLYYRVLIDNIKD 130 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,352,749 Number of Sequences: 28952 Number of extensions: 193810 Number of successful extensions: 292 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -