BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0082 (660 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC062544-1|AAH62544.1| 173|Homo sapiens MARVEL domain containin... 30 8.4 BC004995-1|AAH04995.1| 173|Homo sapiens MARVEL domain containin... 30 8.4 >BC062544-1|AAH62544.1| 173|Homo sapiens MARVEL domain containing 1 protein. Length = 173 Score = 29.9 bits (64), Expect = 8.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 583 GAVHSATSIKVTFYICTLYIFFLN*VHKHDI 491 G VH A + V F++ TL ++FL + KH++ Sbjct: 56 GPVHFALFVSVLFWLLTLGLYFLTLLGKHEL 86 >BC004995-1|AAH04995.1| 173|Homo sapiens MARVEL domain containing 1 protein. Length = 173 Score = 29.9 bits (64), Expect = 8.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 583 GAVHSATSIKVTFYICTLYIFFLN*VHKHDI 491 G VH A + V F++ TL ++FL + KH++ Sbjct: 56 GPVHFALFVSVLFWLLTLGLYFLTLLGKHEL 86 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,723,919 Number of Sequences: 237096 Number of extensions: 1553579 Number of successful extensions: 1952 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1952 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7422585720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -