BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0079 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31A2.09c |apm4||AP-2 adaptor complex subunit Apm4 |Schizosac... 57 2e-09 SPBP16F5.07 |apm1||AP-1 adaptor complex subunit Apm1 |Schizosacc... 39 5e-04 SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces... 28 1.3 SPAC57A7.04c |pabp||mRNA export shuttling protein |Schizosacchar... 25 7.2 SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosacch... 25 9.5 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 25 9.5 >SPAC31A2.09c |apm4||AP-2 adaptor complex subunit Apm4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 446 Score = 57.2 bits (132), Expect = 2e-09 Identities = 31/77 (40%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +2 Query: 26 KILTPLNTSGVQLICLKGKAKYKASENAIVWKIKRMAGMKETQLSAEIELLETDTKKKWT 205 +I P N +GKA Y+ SEN I WKI R G E AE+EL T ++ W Sbjct: 335 RIPVPTNVVKANPRVNRGKAGYEPSENIINWKIPRFLGETELIFYAEVELSNTTNQQIWA 394 Query: 206 RPPISMGFEV-PFAPSG 253 +PPIS+ F + F SG Sbjct: 395 KPPISLDFNILMFTSSG 411 Score = 32.7 bits (71), Expect = 0.047 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +1 Query: 253 IKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGLYETR 360 + V+YL+V EP + S + IKWVRY R+G E R Sbjct: 412 LHVQYLRVSEP--SNSKYKSIKWVRYSTRAGTCEIR 445 >SPBP16F5.07 |apm1||AP-1 adaptor complex subunit Apm1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 426 Score = 39.1 bits (87), Expect = 5e-04 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +1 Query: 190 QEEVDAPAHLHGVRSSLCTLRIKVRYLKVFEPKLNYSDHDVIKWVRYIGRSG 345 Q + P L T I+VRYLK+ EPKLNY + WVRY+ ++G Sbjct: 371 QVQKKRPVQLKFAIPYFTTSGIQVRYLKITEPKLNY---HAMPWVRYVTQNG 419 >SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3131 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 309 VMVRVIQLRFEHLQVANLDPEG 244 + +R I +RFEHL V+N+ P G Sbjct: 150 INIRDIHIRFEHLPVSNVVPGG 171 >SPAC57A7.04c |pabp||mRNA export shuttling protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 653 Score = 25.4 bits (53), Expect = 7.2 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -2 Query: 301 PSNSASVRTPSGSEP*SGGC-KGNFEP 224 P+N++SV TPSG+ P S G +P Sbjct: 63 PTNASSVATPSGTAPTSASLYVGELDP 89 >SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 476 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 41 LNTSGVQLICLKGKAKYKASENA 109 LN V+ + L+GK Y + ENA Sbjct: 172 LNPKNVEALVLRGKVMYYSGENA 194 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 25.0 bits (52), Expect = 9.5 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +2 Query: 68 CLKGKAKYKASENAIVWKIKRMAGMKETQLSAEIELLETDTKK 196 C KG + + E AI WK+ MA K S ELL T K Sbjct: 438 CQKGVEESASEEEAINWKL-LMAVSKRASRSKFAELLGYKTLK 479 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,070,343 Number of Sequences: 5004 Number of extensions: 33894 Number of successful extensions: 80 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -