BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0079 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24749| Best HMM Match : Adap_comp_sub (HMM E-Value=2.24208e-44) 81 1e-15 SB_32450| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 >SB_24749| Best HMM Match : Adap_comp_sub (HMM E-Value=2.24208e-44) Length = 331 Score = 80.6 bits (190), Expect = 1e-15 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 253 IKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGLYETRC 363 +KVRYLKVFEPKLNYSDHD IKWVRYI RSGLYETRC Sbjct: 295 LKVRYLKVFEPKLNYSDHDTIKWVRYISRSGLYETRC 331 >SB_32450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 570 Score = 38.3 bits (85), Expect = 0.005 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +2 Query: 83 AKYKASENAIVWKIKRMAGMKETQLSAEIELLETDTKKKWTRPPISMGFEVP 238 A+YK +E ++W++K + G E ++ +++L + + P+S+ FE+P Sbjct: 234 AEYKTAEKLLLWQVKSIRGGAEVAINIKLKLKDKAKSARKELGPVSLDFEIP 285 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,651,019 Number of Sequences: 59808 Number of extensions: 268851 Number of successful extensions: 657 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -