BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0067 (661 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.9 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +1 Query: 127 NEFYNLIKYNVTYRNITYVMLNRILPRTCSLLNSASYNFRHY 252 NEF L+K+ + R + M+N+ + +L Y+ + + Sbjct: 78 NEFMQLLKHGMLPRGQVFTMMNKEMRHQAVVLFRLLYSAKTF 119 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +1 Query: 127 NEFYNLIKYNVTYRNITYVMLNRILPRTCSLLNSASYNFRHY 252 NEF L+K+ + R + M+N+ + +L Y+ + + Sbjct: 78 NEFMQLLKHGMLPRGQVFTMMNKEMRHQAVVLFRLLYSAKTF 119 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = -2 Query: 450 ASFHGQKHFLHQQLYHSHS 394 A H LH +YH H+ Sbjct: 1728 AGLHPNNTLLHSFMYHEHA 1746 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = -2 Query: 450 ASFHGQKHFLHQQLYHSHS 394 A H LH +YH H+ Sbjct: 1724 AGLHPNNTLLHSFMYHEHA 1742 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,136 Number of Sequences: 438 Number of extensions: 3307 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -