BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0054 (659 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68117-1|CAA92181.2| 459|Caenorhabditis elegans Hypothetical pr... 28 6.8 Z48178-5|CAA88205.1| 413|Caenorhabditis elegans Hypothetical pr... 27 8.9 >Z68117-1|CAA92181.2| 459|Caenorhabditis elegans Hypothetical protein F45E6.3 protein. Length = 459 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +1 Query: 271 QLMSFPSEYSFPKTVTRKQCYRLLGNSVNVKVISELLQILF 393 Q + ++S V RK C+ L+ N +N +I + +ILF Sbjct: 200 QFFEYSYKFSQESLVFRKNCFNLMPNILNQFIIKIVERILF 240 >Z48178-5|CAA88205.1| 413|Caenorhabditis elegans Hypothetical protein C05C10.4 protein. Length = 413 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +2 Query: 524 IRCYIFANFLYKKKIEEGECAIIGTRCTSYMLYIE*Y 634 +R + N ++ + E+ CA +G CTSY+ ++ Y Sbjct: 273 VRSGVIINEVFNRANEKLNCAELGQNCTSYLNKLKFY 309 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,175,896 Number of Sequences: 27780 Number of extensions: 248551 Number of successful extensions: 461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -