BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0052 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 3.4 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 4.5 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 7.8 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 479 LSTVLLNRFVLWVRFHDKR 535 LS V++ F+ W FH +R Sbjct: 262 LSAVVITFFICWAPFHVQR 280 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 479 LSTVLLNRFVLWVRFHDKR 535 LS V++ F+ W FH +R Sbjct: 272 LSAVVILFFICWAPFHTQR 290 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 7.8 Identities = 19/74 (25%), Positives = 32/74 (43%) Frame = +2 Query: 221 VRLRSHTYPISFYIRLVKHFQ*YGLLSKALGVDFILIVIICVNVSPKYGSDTLINLGYCL 400 V L T ISF LV + LG+ +L +++ + + K T + L Sbjct: 238 VNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIA 297 Query: 401 RSLVSTFLQRTPAI 442 + L+ TF+ T +I Sbjct: 298 KYLLFTFIMNTVSI 311 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,550 Number of Sequences: 438 Number of extensions: 3323 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -