BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0048 (651 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132874-5|CAI42607.1| 451|Homo sapiens minichromosome maintena... 31 4.7 BC027994-1|AAH27994.1| 605|Homo sapiens beta-transducin repeat ... 30 8.2 AL627424-17|CAI41042.1| 605|Homo sapiens beta-transducin repeat... 30 8.2 AL445463-2|CAI12963.1| 605|Homo sapiens beta-transducin repeat ... 30 8.2 AL445463-1|CAI12962.1| 191|Homo sapiens beta-transducin repeat ... 30 8.2 AL133387-1|CAH70020.1| 605|Homo sapiens beta-transducin repeat ... 30 8.2 AF101784-1|AAD08702.1| 605|Homo sapiens b-TRCP variant E3RS-Ika... 30 8.2 >AL132874-5|CAI42607.1| 451|Homo sapiens minichromosome maintenance complex component 9 protein. Length = 451 Score = 30.7 bits (66), Expect = 4.7 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 4/60 (6%) Frame = -3 Query: 322 SKIEQMFELQHLKTKFPSAQKAQELLSHLGNLMTNPRRHQNQRQSE--KSARG--RLVES 155 SK E+++ ++ +KT F + Q LS +GN + R +Q QRQS+ +AR RL+ES Sbjct: 356 SKSEKLWSMEKMKTYFCLIRNLQPTLSDVGNQVL-LRYYQMQRQSDCRNAARTTIRLLES 414 >BC027994-1|AAH27994.1| 605|Homo sapiens beta-transducin repeat containing protein. Length = 605 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 268 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 411 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 >AL627424-17|CAI41042.1| 605|Homo sapiens beta-transducin repeat containing protein. Length = 605 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 268 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 411 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 >AL445463-2|CAI12963.1| 605|Homo sapiens beta-transducin repeat containing protein. Length = 605 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 268 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 411 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 >AL445463-1|CAI12962.1| 191|Homo sapiens beta-transducin repeat containing protein. Length = 191 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 268 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 411 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 2 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 50 >AL133387-1|CAH70020.1| 605|Homo sapiens beta-transducin repeat containing protein. Length = 605 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 268 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 411 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 >AF101784-1|AAD08702.1| 605|Homo sapiens b-TRCP variant E3RS-IkappaB protein. Length = 605 Score = 29.9 bits (64), Expect = 8.2 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 268 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 411 PR W + + S+ S C+Y PG G L + SS N PP++ Sbjct: 20 PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,372,796 Number of Sequences: 237096 Number of extensions: 2126935 Number of successful extensions: 4061 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4054 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -