BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0044 (661 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. 23 6.5 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 8.5 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 8.5 >AY752903-1|AAV30077.1| 93|Anopheles gambiae peroxidase 9 protein. Length = 93 Score = 23.4 bits (48), Expect = 6.5 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +1 Query: 295 EEQKKNEIASFQHLSYY 345 +E ++ IA +QH++YY Sbjct: 12 QEARRINIAQYQHINYY 28 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 299 NKKKTKSLLFSIFHIIAHMIIWKEKNIYIFV 391 +K K KSL S+ ++A ++ W I + + Sbjct: 408 HKAKMKSLRISVVIVVAFVVCWTPYYIMMLI 438 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 299 NKKKTKSLLFSIFHIIAHMIIWKEKNIYIFV 391 +K K KSL S+ ++A ++ W I + + Sbjct: 409 HKAKMKSLRISVVIVVAFVVCWTPYYIMMLI 439 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 724,913 Number of Sequences: 2352 Number of extensions: 16183 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -