BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0039 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8257| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_18191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_8257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 30.7 bits (66), Expect = 1.1 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +1 Query: 364 PRCSERTEGISL-TVFETFLPLSPVGLLLQQLPDEQGRIREALQEIIGRSWEKTIGLIKH 540 PR S +G++L +VF + LS V ++ LP Q E ++ + KTI + Sbjct: 406 PRSSRIAKGLALWSVF--IITLSTVSFCVETLPQFQHDKIEKIRHATSHAHNKTILQRVN 463 Query: 541 VTKRGGKMDFSSHTTLKGDKGSNYTVEVGH 630 VTK ++ + T++G+ + T V H Sbjct: 464 VTKGNTTVEVLVNKTIRGESTTWSTEMVDH 493 >SB_18191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 395 ASLYLKRSYHYLLSASYFNNYQTNREGFAKLFRKLSDD 508 +++ L HYL S + F NYQ +G LF++ D+ Sbjct: 326 STILLNAGLHYLESTN-FTNYQRLIDGIVLLFKRAKDE 362 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,489,187 Number of Sequences: 59808 Number of extensions: 373218 Number of successful extensions: 901 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 901 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -