BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0031 (661 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 25 2.1 AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 23 8.5 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 25.0 bits (52), Expect = 2.1 Identities = 14/55 (25%), Positives = 23/55 (41%) Frame = -3 Query: 347 PSLNHVICGRGLPFAMQRNAILCPSEYSRSKVRPVKSLLHHYYCSIGRILGLGTC 183 PS+ V+ +P QR ++ + + LH+Y C I+G G C Sbjct: 342 PSIEKVMGHATMPEKQQRQTLMFSATFPAEIQELAGKFLHNYICVFVGIVG-GAC 395 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 8.5 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +3 Query: 273 TGAQDRVPLHREG*PAAAYHVVQGRSGNIRSSLFTHSRMAN 395 T AQ R+PL P AY R G +H R+A+ Sbjct: 54 TNAQTRIPLPNITAPDLAYADAVSRRGGFSIFHPSHQRVAS 94 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,055 Number of Sequences: 2352 Number of extensions: 13811 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -