BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0031 (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02730.1 68414.m00226 cellulose synthase family protein simil... 29 3.6 At1g17390.1 68414.m02122 hypothetical protein 28 4.8 >At1g02730.1 68414.m00226 cellulose synthase family protein similar to cellulose synthase catalytic subunit [gi:13925881] from Nicotiana alata, cellulose synthase-4 [gi:9622880] from Zea mays Length = 1181 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 131 RPRSRTKSKVQIGLPITGKYRDPESD 208 RP++ K ++ LPI G+Y + E+D Sbjct: 767 RPKAMMKKDDEVSLPINGEYNEEEND 792 >At1g17390.1 68414.m02122 hypothetical protein Length = 272 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 242 KSLLHHYYCSIGRILGLGTCP*SATRSAPSTWSCSW 135 KSLL Y ++G + + CP + T S W W Sbjct: 20 KSLLEWIYANLGEEIEINGCPWAVTFSQAIWWGWKW 55 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,362,046 Number of Sequences: 28952 Number of extensions: 268295 Number of successful extensions: 582 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -