BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0011 (666 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 6.9 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 9.1 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 9.1 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 6.9 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 201 RVLLLVSTANTIQKSRRTIVTLKNLTPSPFIKCYLD 308 + L + AN K I+ NL+ P+I YLD Sbjct: 435 KALKRLERANNGVKIPLVIIWSSNLSKRPYIYKYLD 470 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.0 bits (42), Expect = 9.1 Identities = 5/7 (71%), Positives = 7/7 (100%) Frame = +1 Query: 208 CFWYLPQ 228 CFWY+P+ Sbjct: 460 CFWYVPK 466 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 9.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 231 TIQKSRRTIVTLKNLTPSPF 290 T+Q S T TLKN SP+ Sbjct: 249 TVQLSTCTRTTLKNNRASPY 268 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,146 Number of Sequences: 336 Number of extensions: 3425 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -