BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0007 (642 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 32 0.37 At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.49 At4g02710.1 68417.m00366 kinase interacting family protein simil... 29 3.5 At5g64710.2 68418.m08135 expressed protein contains Pfam profile... 28 4.6 At5g64710.1 68418.m08134 expressed protein contains Pfam profile... 28 4.6 At3g12810.1 68416.m01598 SNF2 domain-containing protein / helica... 28 4.6 At1g77270.1 68414.m08999 expressed protein 28 4.6 At2g26780.1 68415.m03212 expressed protein contains Pfam profile... 27 8.0 At2g04230.1 68415.m00410 F-box family protein contains F-box dom... 27 8.0 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 31.9 bits (69), Expect = 0.37 Identities = 21/59 (35%), Positives = 30/59 (50%) Frame = +3 Query: 69 DEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 245 D K +K+H CL+ + DE N L+T + K + P+K+ A L K KDGK Sbjct: 77 DVHKSFVKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.49 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -2 Query: 404 ERASGLSRGSISHNSRLFGEGCCLCWPGKRQS 309 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -2 Query: 425 DYVFTRKERASGLSRGSISHNSRLFGEGCCL 333 DYVFT +E A +S+G+ + L EG CL Sbjct: 781 DYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At5g64710.2 68418.m08135 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 716 Score = 28.3 bits (60), Expect = 4.6 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +3 Query: 45 VVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 215 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 237 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 296 Query: 216 KSQLMTKDGKFKK 254 S KDG KK Sbjct: 297 VSSFEEKDGFLKK 309 >At5g64710.1 68418.m08134 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 841 Score = 28.3 bits (60), Expect = 4.6 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +3 Query: 45 VVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 215 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 362 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 421 Query: 216 KSQLMTKDGKFKK 254 S KDG KK Sbjct: 422 VSSFEEKDGFLKK 434 >At3g12810.1 68416.m01598 SNF2 domain-containing protein / helicase domain-containing protein similar to transcriptional activator SRCAP [Homo sapiens] GI:5106572; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2055 Score = 28.3 bits (60), Expect = 4.6 Identities = 23/57 (40%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +3 Query: 105 DCLSETKADEQLV--NKLK-TGDFKTENEPLKKYALCMLIKSQLMTKDGKFKKTSLW 266 D L +K + +V N+LK T KT KK+ M IK LM K K KK +LW Sbjct: 1610 DELEPSKPSDSMVVDNELKLTNRGKTVG---KKFITSMPIKRVLMIKPEKLKKGNLW 1663 >At1g77270.1 68414.m08999 expressed protein Length = 682 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/66 (24%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Frame = +3 Query: 90 KKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQ---LMTKDGKFKKTS 260 KK + +++T ++++ D T+ K +LC + + L+ +DGK K+T+ Sbjct: 174 KKPKKSVVAKTIVWQEIIEIESATDTDTDEVGGKTLSLCGKVDASGDDLLARDGKTKRTN 233 Query: 261 LWLKCL 278 L + C+ Sbjct: 234 LQIVCV 239 >At2g26780.1 68415.m03212 expressed protein contains Pfam profile TBP (TATA-binding protein) -interacting protein 120 (TIP120); contains TIGRFAM profile TIGR01612: reticulocyte binding protein Length = 1866 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 316 RLPGQQRQQPSPNSLELCEMLPRERPE 396 R P ++R++ +PN+LE LP++ E Sbjct: 114 RAPAKEREEIAPNTLENVSKLPKQHQE 140 >At2g04230.1 68415.m00410 F-box family protein contains F-box domain Pfam:PF00646 Length = 448 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 278 NAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHE 385 ++ KL++ KL D L + +P + WN KC E Sbjct: 333 DSSPKLQILKLTDVYLHDNKTNPDERKWNPPKCAPE 368 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,234,617 Number of Sequences: 28952 Number of extensions: 276210 Number of successful extensions: 753 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 753 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -