BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0001 (677 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 1.7 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 2.3 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 23 3.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 4.0 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 21 7.0 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 21 7.0 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.3 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.4 bits (48), Expect = 1.7 Identities = 16/72 (22%), Positives = 29/72 (40%) Frame = +3 Query: 72 NFYPPFSIKTKMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGF 251 +F P S+ + + + D + K+ V N G N + ++ N W+ RN Sbjct: 463 DFQPRGSVFVRFTHLQNQDFTYKITVNNSGNNRMGTCRIFLAPQFDERGNPWLFRNQKDM 522 Query: 252 AL*NSKTPVMLK 287 + + V LK Sbjct: 523 FIELDRFAVSLK 534 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.0 bits (47), Expect = 2.3 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 244 GGFRATHTLRMLPYLENIFSISYLD--ALVPKLPTYTLQ 134 G F+A + L L L N+ S Y D AL P L L+ Sbjct: 206 GAFKAENLLVTLTVLPNVNSTVYYDPRALSPNLEFVVLE 244 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -2 Query: 307 IKSTNRVFSITGVFEFYNANPGGFRATHTL 218 +K + I G+F N PG FR L Sbjct: 64 LKPIYALMRIVGIFPIKNTEPGMFRVAPEL 93 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 4.0 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 410 SMIGGGDYDCVTC 372 S++ G+Y CVTC Sbjct: 864 SIVSLGEYKCVTC 876 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 563 HIVLSKSAQLLNTWFCCQ 510 HI L+ +A ++N FC Q Sbjct: 268 HIKLTDTAHMINYAFCVQ 285 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 563 HIVLSKSAQLLNTWFCCQ 510 HI L+ +A ++N FC Q Sbjct: 268 HIKLTDTAHMINYAFCVQ 285 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/26 (26%), Positives = 16/26 (61%) Frame = -2 Query: 235 RATHTLRMLPYLENIFSISYLDALVP 158 R+TH+++ YL+ + + ++ L P Sbjct: 12 RSTHSMKNFKYLKVLVTFAHFICLFP 37 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,054 Number of Sequences: 336 Number of extensions: 2917 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -