SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte9n01
         (391 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC663.02 |wtf14||wtf element Wtf14|Schizosaccharomyces pombe|c...    25   4.1  
SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosacch...    24   9.5  

>SPCC663.02 |wtf14||wtf element Wtf14|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 222

 Score = 25.0 bits (52), Expect = 4.1
 Identities = 11/37 (29%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = -3

Query: 143 PSILINLXIFTVIL-KYM*FSNHN**KKILFDVGMNG 36
           P++L+ + +  + L KY+ F+N +   ++LF +G  G
Sbjct: 72  PAVLLPVFVINIALFKYLVFANFSTKDRVLFGLGNGG 108


>SPBC32H8.13c |mok12||alpha-1,3-glucan synthase
           Mok12|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2352

 Score = 23.8 bits (49), Expect = 9.5
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -2

Query: 207 NHPPGWNLRSNF 172
           NHPP W   SNF
Sbjct: 275 NHPPWWRQLSNF 286


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,498,629
Number of Sequences: 5004
Number of extensions: 25710
Number of successful extensions: 59
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 59
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 128029482
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -