Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte9h06
         (774 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_04_0199 - 20861793-20862023,20862588-20862798,20863260-208641...    29   4.1  

>02_04_0199 -
           20861793-20862023,20862588-20862798,20863260-20864142,
           20864363-20865608
          Length = 856

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 19/68 (27%), Positives = 29/68 (42%)
 Frame = +3

Query: 561 RTFIESDIQNVCKLIYFFHDTFLPNNRHNLTANSIWKTIFFNLIFSVDL*QSNLIVIHKP 740
           R  I  D+ N   L Y  HD F P    ++T+N+I   + F    S D   + ++ +   
Sbjct: 345 RINIVKDVDNA--LSYIHHDCFAPIVHRDITSNNILLDLEFRACIS-DFGIAKILDVEAS 401

Query: 741 RCTNWTST 764
            CT    T
Sbjct: 402 NCTKLAGT 409


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,192,254
Number of Sequences: 37544
Number of extensions: 279501
Number of successful extensions: 395
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 391
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 395
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2068401984
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)