SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte9d16
         (660 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.               23   2.6  
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          21   7.9  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      21   7.9  
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    21   7.9  

>DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.
          Length = 152

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 9/31 (29%), Positives = 17/31 (54%)
 Frame = -2

Query: 599 KILKQVIFSTQNNQICYTVIGYRLCFINCMK 507
           KI++Q + + +N   C T   +  C I+ +K
Sbjct: 96  KIIRQCVDNAKNEDKCLTAQKFSRCVIDYVK 126


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 508 FMQLMKHNLYP 540
           FMQL+KH + P
Sbjct: 80  FMQLLKHGMLP 90


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 508 FMQLMKHNLYP 540
           FMQL+KH + P
Sbjct: 80  FMQLLKHGMLP 90


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = +2

Query: 20  NNKYIFNKQSI*IIGCTVISLEVKQQIGN 106
           NN Y FN+ +  I+G  V  L +  +  N
Sbjct: 557 NNDYNFNEVNFRILGANVNDLIMNTRCAN 585


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,668
Number of Sequences: 438
Number of extensions: 3792
Number of successful extensions: 14
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19855845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -