BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte9c16
(386 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q6CII4 Cluster: Similar to sp|P36083 Saccharomyces cere... 33 1.9
>UniRef50_Q6CII4 Cluster: Similar to sp|P36083 Saccharomyces
cerevisiae YKL075c hypothetical protein singleton; n=1;
Kluyveromyces lactis|Rep: Similar to sp|P36083
Saccharomyces cerevisiae YKL075c hypothetical protein
singleton - Kluyveromyces lactis (Yeast) (Candida
sphaerica)
Length = 372
Score = 33.1 bits (72), Expect = 1.9
Identities = 14/30 (46%), Positives = 22/30 (73%)
Frame = +2
Query: 98 SFVSIVYVKSFLDVLKVTDNLIIKL*RPYD 187
SF+S ++ K DV K++DN+++KL RP D
Sbjct: 58 SFISCIHRKINHDVSKISDNVVLKLIRPMD 87
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 286,533,931
Number of Sequences: 1657284
Number of extensions: 4501491
Number of successful extensions: 6803
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6675
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6803
length of database: 575,637,011
effective HSP length: 91
effective length of database: 424,824,167
effective search space used: 15718494179
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -