SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte8i18
         (627 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc...    25   1.5  
AY146743-1|AAO12103.1|  192|Anopheles gambiae odorant-binding pr...    25   1.5  
AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding pr...    23   6.0  
AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding pr...    23   6.0  

>EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium
            channel alpha2-delta subunit 1 protein.
          Length = 1256

 Score = 25.4 bits (53), Expect = 1.5
 Identities = 16/52 (30%), Positives = 23/52 (44%)
 Frame = +3

Query: 207  PLLDFQQVSFSVTRPCTSMNDQEKPKREEEKKVGLIQRFKEMYRDYWYVLLP 362
            PL+D+Q +      P T   +  KP R       L+Q F   +  YW  +LP
Sbjct: 997  PLMDYQGICSDRDNPYTGAGEPLKPVRPMS---WLLQYFVS-FATYWLSVLP 1044


>AY146743-1|AAO12103.1|  192|Anopheles gambiae odorant-binding
           protein AgamOBP11 protein.
          Length = 192

 Score = 25.4 bits (53), Expect = 1.5
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = +3

Query: 180 CCHHNFVNRPLLDFQQVSFSVTRPCTSMNDQE 275
           CC  NF NR L+  QQ S      CT+   QE
Sbjct: 126 CCE-NFSNRHLVCLQQNSLPCPDRCTAAYKQE 156


>AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding
           protein AgamOBP42 protein.
          Length = 288

 Score = 23.4 bits (48), Expect = 6.0
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 408 YNSSYRTIQRKSP 370
           YN +YR I+RK+P
Sbjct: 104 YNRTYRCIERKAP 116


>AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding
           protein OBPjj83d protein.
          Length = 288

 Score = 23.4 bits (48), Expect = 6.0
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 408 YNSSYRTIQRKSP 370
           YN +YR I+RK+P
Sbjct: 104 YNRTYRCIERKAP 116


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 654,253
Number of Sequences: 2352
Number of extensions: 13931
Number of successful extensions: 56
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 55
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61050630
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -