BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte8e20
(659 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 6.8
EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 9.0
>DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory
protein 15 protein.
Length = 146
Score = 21.4 bits (43), Expect = 6.8
Identities = 8/11 (72%), Positives = 8/11 (72%)
Frame = +2
Query: 32 EN*FNPHHENK 64
E FNPHHE K
Sbjct: 100 ETKFNPHHEIK 110
>EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive
peptide receptor 1 protein.
Length = 374
Score = 21.0 bits (42), Expect = 9.0
Identities = 9/47 (19%), Positives = 23/47 (48%)
Frame = -2
Query: 142 LLHEDIVQKGRVECNSREHCRTHGESFVFVVGIELIFFEYSRIVLIF 2
+ +E+ + KG+++C H + + ++ +V + L S I +
Sbjct: 159 IFYEEKIVKGKLQCWIEFHPQWKWQVYMTLVSLSLFIIPASIIATCY 205
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 149,996
Number of Sequences: 336
Number of extensions: 3157
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17073220
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -