BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte7d11
(181 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
04_01_0612 + 8036625-8036751,8036917-8037110,8037463-8038230 26 4.9
>04_01_0612 + 8036625-8036751,8036917-8037110,8037463-8038230
Length = 362
Score = 25.8 bits (54), Expect = 4.9
Identities = 11/36 (30%), Positives = 18/36 (50%)
Frame = -1
Query: 133 YRSLQWTETISSMDVLSIISNKLRTLLKEYTLFPFS 26
Y +L+WT+ SS + ++ +L L PFS
Sbjct: 83 YSNLRWTQNTSSPQAFKVQPHRHAVILCSSPLLPFS 118
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,266,900
Number of Sequences: 37544
Number of extensions: 54816
Number of successful extensions: 122
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 122
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 122
length of database: 14,793,348
effective HSP length: 39
effective length of database: 13,329,132
effective search space used: 266582640
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -