SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte6n21
         (122 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase prec...    19   4.2  
DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    19   5.5  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    19   7.3  
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    18   9.6  

>AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase
           precursor protein.
          Length = 156

 Score = 19.4 bits (38), Expect = 4.2
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 5   FVSFSLLNF 31
           F SFSLLNF
Sbjct: 141 FKSFSLLNF 149


>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 19.0 bits (37), Expect = 5.5
 Identities = 7/31 (22%), Positives = 18/31 (58%)
 Frame = -1

Query: 95  LHACHLVLFSQITSSSHSPLFQNLTKKMIQI 3
           L   HL+ ++ + ++  S   +N+T+ + +I
Sbjct: 14  LQMIHLIAWASLENTGISDRLENVTQTISRI 44


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 18.6 bits (36), Expect = 7.3
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -1

Query: 50  SHSPLFQNLTKKM 12
           +H P F NLT+ +
Sbjct: 880 THRPTFANLTQTL 892


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 18.2 bits (35), Expect = 9.6
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = +1

Query: 91  CKGIHTT 111
           C G+HTT
Sbjct: 405 CNGLHTT 411


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,708
Number of Sequences: 438
Number of extensions: 268
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 21
effective length of database: 137,145
effective search space used:  2605755
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (18.9 bits)

- SilkBase 1999-2023 -