BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte6k02
(533 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A2EWI5 Cluster: Surface antigen BspA-like; n=4; Trichom... 32 9.5
>UniRef50_A2EWI5 Cluster: Surface antigen BspA-like; n=4;
Trichomonas vaginalis G3|Rep: Surface antigen BspA-like
- Trichomonas vaginalis G3
Length = 1111
Score = 31.9 bits (69), Expect = 9.5
Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 4/41 (9%)
Frame = +3
Query: 390 CRSFTFTDYSNIFSFCYS---VKTTEL-PAIGHVAHSIVYN 500
C +F FT+ ++ +C+S VK EL P I ++ H YN
Sbjct: 843 CTTFKFTNVVTLYDYCFSGSNVKYLELPPTISYIGHYCFYN 883
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 400,783,188
Number of Sequences: 1657284
Number of extensions: 6482238
Number of successful extensions: 14741
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14422
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14741
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 33739557507
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -