Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte6e05
         (142 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7RPL1 Cluster: Cation-transporting ATPase; n=4; Plasmo...    32   2.1  

>UniRef50_Q7RPL1 Cluster: Cation-transporting ATPase; n=4; Plasmodium
            (Vinckeia)|Rep: Cation-transporting ATPase - Plasmodium
            yoelii yoelii
          Length = 1682

 Score = 32.3 bits (70), Expect = 2.1
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +2

Query: 5    EYLKRLA*IF-LCIFANIVFYCYSSFKSSVNNY*NSLNKTH 124
            EY+K  + +F LCI  NI+ Y +  +K+++N     +NK H
Sbjct: 1239 EYIKLCSELFTLCITGNIIEYFFREYKNNINLIDMLINKVH 1279


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,171,163
Number of Sequences: 1657284
Number of extensions: 948671
Number of successful extensions: 2650
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2600
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2650
length of database: 575,637,011
effective HSP length: 27
effective length of database: 530,890,343
effective search space used: 10086916517
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)