BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte5k22
(242 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 0.94
DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 1.2
DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 1.2
DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 1.2
DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 1.2
DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 1.2
DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 1.2
DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 1.2
AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 1.2
AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 1.2
AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 1.2
AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 1.2
AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 1.2
AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 1.2
AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 1.2
AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 1.2
AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 1.2
AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 2.2
EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 20 3.8
AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 20 3.8
DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 19 6.7
DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 19 6.7
DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 19 6.7
DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 19 6.7
DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 19 6.7
DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 19 6.7
DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 19 6.7
DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 19 6.7
DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 19 8.8
DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 19 8.8
DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 19 8.8
DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 19 8.8
DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 19 8.8
DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 19 8.8
DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 19 8.8
DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 19 8.8
DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 19 8.8
DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 19 8.8
DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 19 8.8
DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 19 8.8
DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 19 8.8
DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 19 8.8
DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 19 8.8
DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 19 8.8
DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 19 8.8
DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 19 8.8
DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 19 8.8
DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 19 8.8
DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 19 8.8
DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 19 8.8
DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 19 8.8
DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 19 8.8
DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 19 8.8
DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 19 8.8
DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 19 8.8
DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 19 8.8
DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 19 8.8
DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 19 8.8
DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 19 8.8
DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 19 8.8
AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 19 8.8
AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 19 8.8
AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 19 8.8
AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 19 8.8
AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 19 8.8
AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 19 8.8
AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 19 8.8
AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 19 8.8
AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 19 8.8
AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 19 8.8
AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 19 8.8
AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 19 8.8
AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 19 8.8
AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 19 8.8
AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 19 8.8
AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 19 8.8
AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 19 8.8
AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 19 8.8
>AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine
receptor protein.
Length = 694
Score = 22.2 bits (45), Expect = 0.94
Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 5/51 (9%)
Frame = -3
Query: 156 SCRAMPSASQHMPAGMTTSPRSSQP---LLPMSP--LGMDQILGLVSDVHI 19
S A+ S S P G ++SP S P +SP LG + G +SD+ +
Sbjct: 72 SAAAITSTSPSYPGGGSSSPSPSSPSSFFSSVSPTSLGSENYTG-ISDLFV 121
>DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 144 PNPRFGP 150
>DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex
determiner protein.
Length = 152
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 144 PNPRFGP 150
>AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein.
Length = 401
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein.
Length = 400
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 392 PNPRFGP 398
>AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex
determiner protein.
Length = 385
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 377 PNPRFGP 383
>AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex
determiner protein.
Length = 401
Score = 21.8 bits (44), Expect = 1.2
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +3
Query: 36 PNPRFGP 56
PNPRFGP
Sbjct: 393 PNPRFGP 399
>AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter
Am-EAAT protein.
Length = 543
Score = 21.0 bits (42), Expect = 2.2
Identities = 10/37 (27%), Positives = 23/37 (62%)
Frame = +3
Query: 66 VTLAVVVGYFLGKLSYQQACAEKLMALPGSYIGQILR 176
V + +++G FLG+L+ + L++ PG + ++L+
Sbjct: 73 VLVGLILG-FLGRLANPTPQSITLISFPGELLMRLLK 108
>EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein.
Length = 683
Score = 20.2 bits (40), Expect = 3.8
Identities = 9/17 (52%), Positives = 12/17 (70%)
Frame = -1
Query: 134 LLSTCLLV*QLPQEVAN 84
L S CLLV +P +VA+
Sbjct: 12 LASLCLLVQAVPNKVAD 28
>AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein.
Length = 683
Score = 20.2 bits (40), Expect = 3.8
Identities = 9/17 (52%), Positives = 12/17 (70%)
Frame = -1
Query: 134 LLSTCLLV*QLPQEVAN 84
L S CLLV +P +VA+
Sbjct: 12 LASLCLLVQAVPNKVAD 28
>DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 19.4 bits (38), Expect = 6.7
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +3
Query: 27 HLKPNPRFGP 56
H NPRFGP
Sbjct: 163 HPPLNPRFGP 172
>DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 19.4 bits (38), Expect = 6.7
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +3
Query: 27 HLKPNPRFGP 56
H NPRFGP
Sbjct: 163 HPPLNPRFGP 172
>DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 19.4 bits (38), Expect = 6.7
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +3
Query: 27 HLKPNPRFGP 56
H NPRFGP
Sbjct: 163 HPPLNPRFGP 172
>DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex
determiner protein.
Length = 175
Score = 19.4 bits (38), Expect = 6.7
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +3
Query: 27 HLKPNPRFGP 56
H NPRFGP
Sbjct: 163 HPPLNPRFGP 172
>DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 19.4 bits (38), Expect = 6.7
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +3
Query: 27 HLKPNPRFGP 56
H NPRFGP
Sbjct: 167 HPPLNPRFGP 176
>DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex
determiner protein.
Length = 184
Score = 19.4 bits (38), Expect = 6.7
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +3
Query: 27 HLKPNPRFGP 56
H NPRFGP
Sbjct: 172 HPPLNPRFGP 181
>DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex
determiner protein.
Length = 184
Score = 19.4 bits (38), Expect = 6.7
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +3
Query: 27 HLKPNPRFGP 56
H NPRFGP
Sbjct: 172 HPPLNPRFGP 181
>DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex
determiner protein.
Length = 184
Score = 19.4 bits (38), Expect = 6.7
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +3
Query: 27 HLKPNPRFGP 56
H NPRFGP
Sbjct: 172 HPPLNPRFGP 181
>DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 166 NPRFGP 171
>DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 166 NPRFGP 171
>DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 166 NPRFGP 171
>DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 166 NPRFGP 171
>DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 166 NPRFGP 171
>DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 166 NPRFGP 171
>DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 171 NPRFGP 176
>DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 171 NPRFGP 176
>DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 171 NPRFGP 176
>DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 177 NPRFGP 182
>DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 177 NPRFGP 182
>DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 177 NPRFGP 182
>DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 177 NPRFGP 182
>DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 177 NPRFGP 182
>DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex
determiner protein.
Length = 180
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 172 NPRFGP 177
>DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex
determiner protein.
Length = 180
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 172 NPRFGP 177
>DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex
determiner protein.
Length = 182
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 174 NPRFGP 179
>DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 175 NPRFGP 180
>DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex
determiner protein.
Length = 182
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 175 NPRFGP 180
>DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 175 NPRFGP 180
>DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 175 NPRFGP 180
>DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 175 NPRFGP 180
>DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 175 NPRFGP 180
>DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 175 NPRFGP 180
>DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 175 NPRFGP 180
>DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex
determiner protein.
Length = 178
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 170 NPRFGP 175
>DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 178 NPRFGP 183
>DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 178 NPRFGP 183
>DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex
determiner protein.
Length = 189
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 181 NPRFGP 186
>DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex
determiner protein.
Length = 186
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 178 NPRFGP 183
>DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 173 NPRFGP 178
>AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex
determiner protein.
Length = 400
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 392 NPRFGP 397
>AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex
determiner protein.
Length = 406
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 398 NPRFGP 403
>AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex
determiner protein.
Length = 397
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 389 NPRFGP 394
>AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex
determiner protein.
Length = 406
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 398 NPRFGP 403
>AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex
determiner protein.
Length = 408
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 400 NPRFGP 405
>AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex
determiner protein.
Length = 419
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 411 NPRFGP 416
>AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex
determiner protein.
Length = 426
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 418 NPRFGP 423
>AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex
determiner protein.
Length = 396
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 388 NPRFGP 393
>AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex
determiner protein.
Length = 407
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 399 NPRFGP 404
>AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex
determiner protein.
Length = 407
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 399 NPRFGP 404
>AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex
determiner protein.
Length = 396
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 388 NPRFGP 393
>AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex
determiner protein.
Length = 407
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 400 NPRFGP 405
>AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex
determiner protein.
Length = 413
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 406 NPRFGP 411
>AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex
determiner protein.
Length = 414
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 406 NPRFGP 411
>AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex
determiner protein.
Length = 414
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 406 NPRFGP 411
>AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex
determiner protein.
Length = 418
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 410 NPRFGP 415
>AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex
determiner protein.
Length = 425
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 417 NPRFGP 422
>AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex
determiner protein.
Length = 428
Score = 19.0 bits (37), Expect = 8.8
Identities = 6/6 (100%), Positives = 6/6 (100%)
Frame = +3
Query: 39 NPRFGP 56
NPRFGP
Sbjct: 420 NPRFGP 425
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,670
Number of Sequences: 438
Number of extensions: 1720
Number of successful extensions: 92
Number of sequences better than 10.0: 92
Number of HSP's better than 10.0 without gapping: 92
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 92
length of database: 146,343
effective HSP length: 47
effective length of database: 125,757
effective search space used: 4149981
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)
- SilkBase 1999-2023 -